1.67 Rating by CuteStat

alnebrasgroup.com is 7 years 4 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, alnebrasgroup.com is SAFE to browse.

PageSpeed Score
69
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 2
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 6
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 27 Nov 2016 19:46:02 GMT
Server: Apache
Link: <http://alnebrasgroup.com/wp-json/>; rel="https://api.w.org/", <http://alnebrasgroup.com/>; rel=shortlink
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Nov 26, 2016, 12:00 AM 7 years 4 months 4 weeks ago
Last Modified: Nov 26, 2016, 12:00 AM 7 years 4 months 4 weeks ago
Expiration Date: Nov 26, 2017, 12:00 AM 6 years 4 months 3 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
alnebrasgroup.com A 14389 IP: 103.24.200.143
alnebrasgroup.com NS 38519 Target: ns1.lazybulls.com
alnebrasgroup.com NS 38519 Target: ns2.lazybulls.com
alnebrasgroup.com SOA 86399 MNAME: ns1.lazybulls.com
RNAME: manager.catchway.com
Serial: 2016112608
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
alnebrasgroup.com MX 14399 Priority: 10
Target: ALT3.ASPMX.L.GOOGLE.com
alnebrasgroup.com MX 14399 Priority: 10
Target: ALT4.ASPMX.L.GOOGLE.com
alnebrasgroup.com MX 14399 Priority: 1
Target: ASPMX.L.GOOGLE.com
alnebrasgroup.com MX 14399 Priority: 5
Target: ALT1.ASPMX.L.GOOGLE.com
alnebrasgroup.com MX 14399 Priority: 5
Target: ALT2.ASPMX.L.GOOGLE.com

Full WHOIS Lookup

Domain Name: alnebrasgroup.com
Registrar URL: http://www.godaddy.com
Registrant Name: Alnebras Group
Registrant Organization:
Name Server: NS1.LAZYBULLS.COM
Name Server: NS2.LAZYBULLS.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=alnebrasgroup.com

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.